PDB entry 2xrw

View 2xrw on RCSB PDB site
Description: Linear binding motifs for JNK and for calcineurin antagonistically control the nuclear shuttling of NFAT4
Class: transcription
Keywords: transcription, mapk signaling pathways, linear binding motif
Deposited on 2010-09-23, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.1656
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1L4K2 (2-364)
      • expression tag (1)
      • expression tag (365)
    Domains in SCOPe 2.06: d2xrwa1, d2xrwa2, d2xrwa3
  • Chain 'B':
    Compound: nuclear factor of activated t-cells, cytoplasmic 3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xrwA (A:)
    mgsrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsr
    pfqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemikggvlfpgtdhidqwnkvie
    qlgtpcpefmkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardlls
    kmlvidaskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliyke
    vmdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xrwA (A:)
    gsrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrp
    fqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglryyrapev
    ilgmgykenvdiwsvgcimgemikggvlfpgtdhidqwnkvieqlgtpcpefmkklqptv
    rtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvidaskrisvdeal
    qhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdleh
    

  • Chain 'B':
    No sequence available.