PDB entry 2xru

View 2xru on RCSB PDB site
Description: aurora-a t288e complexed with pha-828300
Class: transferase
Keywords: nucleotide-binding, kinase, cell cycle, transferase
Deposited on 2010-09-22, released 2010-09-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xrua_
  • Heterogens: 400

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xruA (A:)
    gprqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtelcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xruA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvcgtldylppemiegrmhdekvdlwsl
    gvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlr
    evlehpwitanssk