PDB entry 2xrm

View 2xrm on RCSB PDB site
Description: Processed Intracellular subtilisin from B. clausii
Class: hydrolase
Keywords: activated form, post-translational modification, hydrolase
Deposited on 2010-09-20, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.20175
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0AB41 (0-End)
      • engineered mutation (231)
    Domains in SCOPe 2.07: d2xrma_
  • Heterogens: NA, SR, CA, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xrmA (A:)
    sevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaeriiggvnlttdyggdet
    nfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdgsgemgwiakairyavd
    wrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaagnegdgredtnefaypa
    ayneviavgavdfdlrlsdftntneeidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqftek
    gkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xrmA (A:)
    sevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaeriiggvnlttdyggdet
    nfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdgsgemgwiakairyavd
    wrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaagnegdgredtnefaypa
    ayneviavgavdfdlrlsdftntneeidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqftek
    g