PDB entry 2xrl

View 2xrl on RCSB PDB site
Description: tet-repressor class d t103a with doxycycline
Class: transcription
Keywords: transcription, antibiotic resistance, DNA-binding, helix-turn-helix
Deposited on 2010-09-16, released 2011-10-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.238
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-206)
      • cloning artifact (0)
      • engineered mutation (101)
    Domains in SCOPe 2.03: d2xrla1, d2xrla2
  • Heterogens: CL, DXT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xrlA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv