PDB entry 2xre

View 2xre on RCSB PDB site
Description: Detection of cobalt in previously unassigned human SENP1 structure
Class: hydrolase
Keywords: hydrolase, cysteine protease
Deposited on 2010-09-14, released 2010-10-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2xrea_
  • Chain 'B':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2xreb_
  • Heterogens: GOL, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xreA (A:)
    dsedefpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfy
    mnmlmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhw
    clavvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqei
    pqqmngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xreA (A:)
    defpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnm
    lmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwcla
    vvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqq
    mngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xreB (B:)
    dsedefpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfy
    mnmlmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhw
    clavvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqei
    pqqmngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xreB (B:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
    ngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll