PDB entry 2xr8

View 2xr8 on RCSB PDB site
Description: crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400
Class: oxidoreductase
Keywords: oxidoreductase, degradation, bpdo
Deposited on 2010-09-12, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.21649
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8a1, d2xr8a2
  • Chain 'B':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8b_
  • Chain 'C':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8c1, d2xr8c2
  • Chain 'D':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8d_
  • Chain 'E':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8e1, d2xr8e2
  • Chain 'F':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8f_
  • Chain 'G':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8g1, d2xr8g2
  • Chain 'H':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8h_
  • Chain 'I':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8i1, d2xr8i2
  • Chain 'J':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8j_
  • Chain 'K':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8k1, d2xr8k2
  • Chain 'L':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8l_
  • Chain 'M':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8m1, d2xr8m2
  • Chain 'N':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8n_
  • Chain 'O':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8o1, d2xr8o2
  • Chain 'P':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8p_
  • Chain 'Q':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8q1, d2xr8q2
  • Chain 'R':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8r_
  • Chain 'S':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8s1, d2xr8s2
  • Chain 'T':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8t_
  • Chain 'U':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8u1, d2xr8u2
  • Chain 'V':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8v_
  • Chain 'W':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8w1, d2xr8w2
  • Chain 'X':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xr8x_
  • Heterogens: FES, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xr8A (A:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8A (A:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xr8B (B:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8B (B:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xr8C (C:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8C (C:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xr8D (D:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8D (D:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xr8E (E:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8E (E:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xr8F (F:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8F (F:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2xr8G (G:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8G (G:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xr8H (H:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8H (H:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2xr8I (I:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8I (I:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2xr8J (J:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8J (J:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2xr8K (K:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8K (K:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2xr8L (L:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8L (L:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2xr8M (M:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8M (M:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2xr8N (N:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8N (N:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2xr8O (O:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8O (O:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2xr8P (P:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8P (P:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2xr8Q (Q:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8Q (Q:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2xr8R (R:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8R (R:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2xr8S (S:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8S (S:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2xr8T (T:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8T (T:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2xr8U (U:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8U (U:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2xr8V (V:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8V (V:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2xr8W (W:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8W (W:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflptfnniriwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2xr8X (X:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr8X (X:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff