PDB entry 2xr6

View 2xr6 on RCSB PDB site
Description: Crystal structure of the complex of the carbohydrate recognition domain of human DC-SIGN with pseudo trimannoside mimic.
Class: sugar binding protein
Keywords: sugar binding protein, carbohydrate binding, mannose
Deposited on 2010-09-10, released 2011-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NNX6
      • engineered mutation (149)
    Domains in SCOPe 2.08: d2xr6a_
  • Heterogens: MAN, 07B, AE9, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2xr6A (A:)
maswshpqfekiegrerlshpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvvi
ksaeeqnflqlqssrsnrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgee
dcaefsgngwnddkcnlakfwickksaasssrdeeqflspapatpnpppa

    Sequence, based on observed residues (ATOM records): (download) 
    >2xr6A (A:)
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaass