PDB entry 2xr0

View 2xr0 on RCSB PDB site
Description: room temperature x-ray structure of the perdeuterated toho-1 r274n r276n double mutant beta-lactamase
Class: hydrolase
Keywords: hydrolase, extended-spectrum beta-lactamases, esbls, ctx-m-type esbls
Deposited on 2010-09-08, released 2010-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.135
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toho-1 beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (0-259)
      • engineered mutation (243)
      • engineered mutation (245)
    Domains in SCOPe 2.08: d2xr0a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xr0A (A:)
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaenrndilaaaakivthgf