PDB entry 2xqu

View 2xqu on RCSB PDB site
Description: microscopic rotary mechanism of ion translocation in the fo complex of atp synthases
Deposited on 2010-09-07, released 2010-10-27
The last revision was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.1909
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CVM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xquA (A:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xquB (B:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2xquC (C:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2xquD (D:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >2xquE (E:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv