PDB entry 2xqs

View 2xqs on RCSB PDB site
Description: microscopic rotary mechanism of ion translocation in the fo complex of atp synthases
Deposited on 2010-09-07, released 2010-10-27
The last revision was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.1955
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CVM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xqsA (A:)
    mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
    mealtiyglvvalvllfanpfv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xqsB (B:)
    mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
    mealtiyglvvalvllfanpfv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2xqsC (C:)
    mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
    mealtiyglvvalvllfanpfv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2xqsD (D:)
    mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
    mealtiyglvvalvllfanpfv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >2xqsE (E:)
    mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
    mealtiyglvvalvllfanpfv