PDB entry 2xqn

View 2xqn on RCSB PDB site
Description: complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Class: metal-binding protein
Keywords: metal-binding protein, cytoskeleton, focal adhesion, acrosome
Deposited on 2010-09-03, released 2011-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.21776
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin-like protein 7a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N8S7 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.03: d2xqnm_
  • Chain 'T':
    Compound: testin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download) 
    >2xqnM (M:)
aarmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhq
vvincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlnsqet

    Sequence, based on observed residues (ATOM records): (download) 
    >2xqnM (M:)
aarmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhq
vvincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

  • Chain 'T':
    No sequence available.