PDB entry 2xqb

View 2xqb on RCSB PDB site
Description: crystal structure of anti-il-15 antibody in complex with human il-15
Class: immune system
Keywords: immune system, affinity maturation
Deposited on 2010-09-01, released 2010-12-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24809
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin 15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2xqba_
  • Chain 'H':
    Compound: anti-il-15 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XQB (0-End)
  • Chain 'L':
    Compound: anti-il-15 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XQB (0-End)
    Domains in SCOPe 2.04: d2xqbl1, d2xqbl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xqbA (A:)
    nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
    dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xqbA (A:)
    nwvnvisdlkkiedliqidatlytesdvhpsckvtamkcfllelqvislesgdasihdtv
    enliilannslstesgckeceeleeknikeflqsfvhivqmfint
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2xqbL (L:)
    tqppsasgtpgqrvtiscsgstsnlkrnyvywyqqlpgtapklliyrdrrrpsgvpdrfs
    gsksgtsaslaisglrsedeadyycawydrelsewvfgggtkltvlqpkaapsvtlfpps
    seelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylslt
    peqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xqbL (L:)
    tqppsasgtpgqrvtiscsgstnyvywyqqlpgtapklliyrdrrrpsgvpdrfsgsksg
    tsaslaisglrsedeadyycawydrelsewvfgggtkltvlqpkaapsvtlfppsseelq
    ankatlvclisdfypgavtvawkadsspvkagvetttpsksnnkyaassylsltpeqwks
    hrsyscqvthegstvektvapt