SCOPe 2.08: Structural Classification of Proteins

PDB entry 2xq1

View 2xq1 on RCSB PDB site
Description: Crystal structure of peroxisomal catalase from the yeast Hansenula polymorpha
Class: oxidoreductase
Keywords: oxidoreductase, hydrogen peroxide detoxification, pts1
Deposited on 2010-08-31, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.19076
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1a_
Chain 'B':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1b1, d2xq1b2
Chain 'C':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1c_
Chain 'D':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1d1, d2xq1d2
Chain 'E':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1e_
Chain 'F':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1f1, d2xq1f2
Chain 'G':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1g_
Chain 'H':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1h_
Chain 'I':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1i_
Chain 'J':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1j1, d2xq1j2
Chain 'K':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1k_
Chain 'L':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1l_
Chain 'M':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1m_
Chain 'N':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1n1, d2xq1n2
Chain 'O':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1o_
Chain 'P':
Compound: peroxisomal catalase
Species: PICHIA ANGUSTA [TaxId:4905]
Database cross-references and differences (RAF-indexed):
- Uniprot P30263
Domains in SCOPe 2.08: d2xq1p_
Heterogens: HEM, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2xq1A (A:)
gamanppvfttsqgcpvsdpfttqripldstgykyappigplllqdfklidtlshfdrer
ipervvhakgagaygvfevtdditdvcsakfldtvgkktriftrfstvggekgsadtard
prgfatkfytedgnldlvynntpiffirdpikfphfihtqkrnpatnlkdpnmfwdylta
ndeslhqvmylfsnrgtpasyrtmngysghtykwynskgewvyvqvhfianqgvhnllde
eagrlagedpdhstrdlweaiekgdypswecyiqtmtleqskklpfsvfdltkvwphkdf
plrhfgrftlnenpknyyaeteqiafspshtvpgmepsndpvlqsrlfsypdthrhrlgp
nyhqipvncplksgsfnpinrdgpmcvdgnlggtpnyanayncpiqyavspkasgnkpde
kytgevvpyhwehtdydyfqpkmfwkvlgrtpgeqeslvknvanhvsaadefiqdrvyey
fskaepiigdlirkkvqelkrkasspski