PDB entry 2xpw

View 2xpw on RCSB PDB site
Description: TetR(D) in complex with oxytetracycline and magnesium.
Class: transcription
Keywords: transcription, transcription regulator, helix-turn-helix, metal coordination
Deposited on 2010-08-30, released 2011-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2xpwa1, d2xpwa2, d2xpwa3
  • Heterogens: OTC, MG, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xpwA (A:)
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
geqaflhgleslirgfevqltallqiv