PDB entry 2xph

View 2xph on RCSB PDB site
Description: Crystal structure of human SENP1 with the bound cobalt
Class: hydrolase
Keywords: hydrolase, cysteine protease, thiol protease
Deposited on 2010-08-26, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23137
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xpha_
  • Chain 'B':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xphb_
  • Heterogens: GOL, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xphA (A:)
    gamadigsdsedefpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwl
    ndeiinfymnmlmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillv
    pihlgvhwclavvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwql
    fskksqeipqqmngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xphA (A:)
    defpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnm
    lmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwcla
    vvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqq
    mngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xphB (B:)
    gamadigsdsedefpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwl
    ndeiinfymnmlmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillv
    pihlgvhwclavvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwql
    fskksqeipqqmngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xphB (B:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
    ngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll