PDB entry 2xpg

View 2xpg on RCSB PDB site
Description: Crystal structure of a MHC class I-peptide complex
Class: immune system
Keywords: immune system, autoimmunity, multiple sclerosis
Deposited on 2010-08-26, released 2011-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class I histocompatibility antigen, a-3 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-97)
      • expression tag (0)
    Domains in SCOPe 2.08: d2xpgb1, d2xpgb2
  • Chain 'C':
    Compound: myelin proteolipid protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xpgB (B:)
    aqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
    

  • Chain 'C':
    No sequence available.