PDB entry 2xp6

View 2xp6 on RCSB PDB site
Description: discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Class: isomerase
Keywords: isomerase, proline directed kinase, cell cycle, oncogenic transformation
Deposited on 2010-08-25, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-166)
      • conflict (17)
      • engineered mutation (134)
    Domains in SCOPe 2.08: d2xp6a1, d2xp6a2
  • Heterogens: 12P, 4G2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2xp6A (A:)
gshgmadeeklppgwekamsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvr
cshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssa
kargdlgafsrgqmakpfedasfalrtgemsgpvftdsgihiilrte

    Sequence, based on observed residues (ATOM records): (download) 
    >2xp6A (A:)
lppgwekamsrssgrvyyfnhitnasqwerpseparvrcshllvkhsqsrrpsswrqeki
trtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmakpfedas
falrtgemsgpvftdsgihiilrte