PDB entry 2xox

View 2xox on RCSB PDB site
Description: crystal structure of pteridine reductase (ptr1) from leishmania donovani
Class: oxidoreductase
Keywords: oxidoreductase, antifolates, short-chain reductase
Deposited on 2010-08-24, released 2011-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23027
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Leishmania donovani [TaxId:5661]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QDB5
      • engineered mutation (60)
    Domains in SCOPe 2.02: d2xoxa_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Leishmania donovani [TaxId:5661]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QDB5
      • engineered mutation (60)
    Domains in SCOPe 2.02: d2xoxb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xoxA (A:)
    mtaptvpvalvtgaakrlgsgiaeglhaegyavclhyhrsaaeantlaatlnarrpnsai
    pvqadlsnvakapaggadgaapvtlfkrcadlvaacythwgrcdvlvnnassfyptpllr
    kdedghvpcvgdreameaaaadlfgsnamapyflikafahrvadtpaeqrgtnysivnmv
    damtsqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvladdmppavred
    yrskvplyqrdssaaevsdvviflcsskakyvtgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xoxA (A:)
    tvpvalvtgaakrlgsgiaeglhaegyavclhyhrsaaeantlaatlnarrpnsaipvqa
    dlsnvapvtlfkrcadlvaacythwgrcdvlvnnasreameaaaadlfgsnamapyflik
    afahrvadtpaeqrgtnysivnmvdamtsqpllgytiytmakgalegltrsaalelaplq
    irvngvgpglaevsdvviflcsskakyvtgtcvkvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xoxB (B:)
    mtaptvpvalvtgaakrlgsgiaeglhaegyavclhyhrsaaeantlaatlnarrpnsai
    pvqadlsnvakapaggadgaapvtlfkrcadlvaacythwgrcdvlvnnassfyptpllr
    kdedghvpcvgdreameaaaadlfgsnamapyflikafahrvadtpaeqrgtnysivnmv
    damtsqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvladdmppavred
    yrskvplyqrdssaaevsdvviflcsskakyvtgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xoxB (B:)
    tvpvalvtgaakrlgsgiaeglhaegyavclhyhrsaaeantlaatlnarrpnsaipvqa
    dlsnvapvtlfkrcadlvaacythwgrcdvlvnnreameaaaadlfgsnamapyflikaf
    ahrvadtpaeqrgtnysivnmvdamtsqpllgytiytmakgalegltrsaalelaplqir
    vngvgpglsaaevsdvviflcsskakyvtgtcvkvd