PDB entry 2xov

View 2xov on RCSB PDB site
Description: Crystal Structure of E.coli rhomboid protease GlpG, native enzyme
Class: hydrolase
Keywords: membrane protein, hydrolase, intramembrane protease
Deposited on 2010-08-24, released 2010-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhomboid protease glpg
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xova_
  • Heterogens: BNG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xovA (A:)
    eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmh
    ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgy
    vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl
    n