PDB entry 2xod

View 2xod on RCSB PDB site
Description: crystal structure of flavoprotein nrdi from bacillus anthracis in the oxidised form
Deposited on 2010-08-14, released 2010-08-25
The last revision was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: N/A
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NrdI protein
    Species: Bacillus anthracis [TaxId:1392]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FMN, ZN, CAC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xodA (A:)
mlvaydsmtgnvkrfihklnmpavqigedlvidedfilityttgfgnvpervleflernn
eklkgvsasgnrnwgdmfgasadkisakyevpivskfelsgtnndveyfkervreiath

    Sequence, based on observed residues (ATOM records):
    >2xodA (A:)
mlvaydsmtgnvkrfihklnmpavqigedlvidedfilityttgfgnvpervleflernn
eklkgvsasgnrnwgdmfgasadkisakyevpivskfelsgtnndveyfkervreiat