PDB entry 2xnq

View 2xnq on RCSB PDB site
Description: structural insights into cis element recognition of non-polyadenylated rnas by the nab3-rrm
Deposited on 2010-08-05, released 2010-09-08
The last revision was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.17567
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear polyadenylated RNA-binding protein 3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38996 (21-96)
      • expression tag (18-20)
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xnqA (A:)
mgsshhhhhhssglvprgshmksrlfignlplknvskedlfrifspyghimqiniknafg
fiqfdnpqsvrdaiecesqemnfgkklilevsssnar

    Sequence, based on observed residues (ATOM records):
    >2xnqA (A:)
shmksrlfignlplknvskedlfrifspyghimqiniknafgfiqfdnpqsvrdaieces
qemnfgkklilevsssnar