PDB entry 2xnm

View 2xnm on RCSB PDB site
Description: structure of nek2 bound to cct
Class: transferase
Keywords: transferase, centrosome, mitosis, cell cycle
Deposited on 2010-08-05, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.1649
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • expression tag (271-278)
    Domains in SCOPe 2.06: d2xnma1, d2xnma2
  • Heterogens: WGZ, EDO, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xnmA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xnmA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
    alkechrrrdlkpanvfldgkqnvklgdfglarilfvgtpyymspeqmnrsyneksdiws
    lgcllyelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrps
    veeilenplilehhhhhh