PDB entry 2xng

View 2xng on RCSB PDB site
Description: structure of aurora-a bound to a selective imidazopyrazine inhibitor
Class: transferase
Keywords: ser-thr protein kinase complex, proto-oncogene, kinase, mitosis, cell cycle, microtubule, transferase, cytoskeleton, cell division
Deposited on 2010-08-02, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2238
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xnga_
  • Heterogens: A0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xngA (A:)
    meskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xngA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhatldylppemiegrmhdekvdlwslg
    vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
    vlehpwitansskp