PDB entry 2xnf

View 2xnf on RCSB PDB site
Description: the mediator med25 activator interaction domain: structure and cooperative binding of vp16 subdomains
Deposited on 2010-08-02, released 2011-03-09
The last revision was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mediator of RNA polymerase II transcription subunit 25
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71SY5 (1-150)
      • expression tag (0)
      • expression tag (151-158)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xnfA (A:)
    msvsnkllawsgvlewqekpkpasvdantkltrslpcqvyvnhgenlkteqwpqklimql
    ipqqllttlgplfrnsrmvqfhftnkdleslkglyrimgngfagcvhfphtapcevrvlm
    llysskkkifmglipydqsgfvngirqvitnlehhhhhh