PDB entry 2xne

View 2xne on RCSB PDB site
Description: structure of aurora-a bound to an imidazopyrazine inhibitor
Class: transferase
Keywords: ser-thr protein kinase complex, proto-oncogene, kinase, mitosis, cell cycle, microtubule, transferase, cytoskeleton, cell division
Deposited on 2010-08-02, released 2010-09-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2401
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (153)
    Domains in SCOPe 2.05: d2xnea_
  • Heterogens: ASH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xneA (A:)
    meskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkianfgwsvhapssrrttlcgtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xneA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfgvehqlrreveiqshlrhpni
    lrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychskrvi
    hrdikpenlllgsagelkianfgwsvhaptldylppemiegrmhdekvdlwslgvlcyef
    lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
    itanss