PDB entry 2xna

View 2xna on RCSB PDB site
Description: crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Class: immune system
Keywords: immune system, superantigen
Deposited on 2010-07-31, released 2010-11-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22461
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell receptor alpha chain c region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XNA (Start-108)
      • engineered mutation (157)
    • Uniprot P01848 (109-End)
    Domains in SCOPe 2.04: d2xnaa1, d2xnaa2
  • Chain 'B':
    Compound: t cell receptor beta-1 chain c region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XNA (Start-113)
      • conflict (117-118)
      • conflict (150)
      • engineered mutation (170)
      • conflict (188)
    • Uniprot P01850 (114-End)
    Domains in SCOPe 2.04: d2xnab1, d2xnab2
  • Chain 'C':
    Compound: enterotoxin h
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2xnac1, d2xnac2
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xnaA (A:)
    mqlleqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkr
    ltfqfgdarkdsslhitaaqpgdtglylcagagsqgnlifgkgtklsvkpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xnaA (A:)
    qlleqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkrl
    tfqfgdarkdsslhitaaqpgdtglylcagagsqgnlifgkgtklsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xnaB (B:)
    mvdggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkg
    diaegysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xnaB (B:)
    dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi
    aegysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvtedlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xnaC (C:)
    edlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfata
    dlaqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiq
    ketelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiyd
    lkgendyeidkiyednktlksddishidvnlytkkkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xnaC (C:)
    edlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfata
    dlaqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiq
    ketelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiyd
    lkgendyeidkiyednktlksddishidvnlytkk