PDB entry 2xn8

View 2xn8 on RCSB PDB site
Description: x-ray structure of the substrate-free mycobacterium tuberculosis cytochrome p450 cyp125
Class: oxidoreductase
Keywords: cholesterol degradation, reverse type I inhibitor, monooxygenase, oxidoreductase
Deposited on 2010-07-30, released 2010-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.14406
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome p450 125
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63709
      • engineered mutation (418)
    Domains in SCOPe 2.03: d2xn8a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xn8A (A:)
    hhhhhhmpspnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdggf
    waitklndvkeisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrki
    isrgftpravgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqedr
    gklfhwsnemtgnedpeyahidpkassaeligyamkmaeekaknpaddivtqliqadidg
    eklsddefgffvvmlavagnettrnsitqgmmafaehpdqwelykkvrpetaadeivrwa
    tpvtafqrtalrdyelsgvqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgfg
    gtgahyciganlarmtinlifnavadhmpdlkpisaperlrsgwlngikhwqvdytgrlp
    vah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xn8A (A:)
    spnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdggfwaitklnd
    vkeisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrkiisrgftpr
    avgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqedrgklfhwsn
    emtgnedpeyahidpkassaeligyamkmaeekakaddivtqliqadgeklsddefgffv
    vmlavagnettrnsitqgmmafaehpdqwelykkvrpetaadeivrwatpvtafqrtalr
    dyelsgvqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgfggtgahyciganl
    armtinlifnavadhmpdlkpisaperlrsgwlngikhwqvdytgrlpv