PDB entry 2xmw

View 2xmw on RCSB PDB site
Description: pacs, n-terminal domain, from synechocystis pcc6803
Class: hydrolase
Keywords: hydrolase, cu(I)-binding, trafficking
Deposited on 2010-07-29, released 2010-08-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.24496
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cation-transporting ATPase pacs
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xmwa_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xmwA (A:)
    maqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdav
    eragyharvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xmwA (A:)
    aqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhtpqiltdaverag
    yharvlk