PDB entry 2xmt

View 2xmt on RCSB PDB site
Description: copper chaperone atx1 from synechocystis pcc6803 (cu1 form)
Class: chaperone
Keywords: chaperone, copper homeostasis, p-type ATPase, metal transport, metallochaperone, cu(I)-binding, cu(I)-cluster, trafficking
Deposited on 2010-07-29, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16256
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ssr2857 protein
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xmta_
  • Chain 'B':
    Compound: ssr2857 protein
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xmtb_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xmtA (A:)
    mtiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasag
    heve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xmtA (A:)
    tiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagh
    eve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xmtB (B:)
    mtiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasag
    heve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xmtB (B:)
    tiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagh
    eve