PDB entry 2xml

View 2xml on RCSB PDB site
Description: Crystal structure of human JMJD2C catalytic domain
Class: oxidoreductase
Keywords: oxidoreductase, transcription regulation, metal binding
Deposited on 2010-07-28, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xmla_
  • Chain 'B':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xmlb_
  • Heterogens: OGA, NI, ZN, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xmlA (A:)
    smevaevesplnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprq
    cyddidnllipapiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedl
    erkywknltfvapiygadingsiydegvdewniarlntvldvveeecgisiegvntpyly
    fgmwkttfawhtedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaf
    lrhkmtlispsvlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwi
    dygkvaklctcrkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xmlA (A:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xmlB (B:)
    smevaevesplnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprq
    cyddidnllipapiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedl
    erkywknltfvapiygadingsiydegvdewniarlntvldvveeecgisiegvntpyly
    fgmwkttfawhtedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaf
    lrhkmtlispsvlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwi
    dygkvaklctcrkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xmlB (B:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk