PDB entry 2xmf

View 2xmf on RCSB PDB site
Description: myosin 1e sh3
Class: motor protein
Keywords: motor protein, sh3 domain
Deposited on 2010-07-27, released 2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17565
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin 1e sh3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TLJ4 (5-59)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2xmfa1, d2xmfa2
  • Heterogens: DIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xmfA (A:)
gplgspqckalyaydaqdtdelsfnandiidiikedpsgwwtgrlrgkqglfpnnyvtki