PDB entry 2xle

View 2xle on RCSB PDB site
Description: cytochrome c prime from alcaligenes xylosoxidans: ferrous r124k variant with bound no
Class: electron transport
Keywords: electron transport, haemoprotein, 4-helix bundle
Deposited on 2010-07-20, released 2010-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.15319
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00138 (0-126)
      • engineered mutation (123)
    Domains in SCOPe 2.06: d2xlea_
  • Heterogens: HEC, NO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xleA (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    daykkkk