PDB entry 2xkr

View 2xkr on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis cyp142: a novel cholesterol oxidase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2010-07-12, released 2010-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1694
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome p450 142
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2xkra_
  • Heterogens: HEM, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xkrA (A:)
    mteapdvdladgnfyasrearaayrwmranqpvfrdrnglaaastyqavidaerqpelfs
    naggirpdqpalpmmidmddpahllrrklvnagftrkrvkdkeasiaalcdtlidavcer
    gecdfvrdlaaplpmavigdmlgvrpeqrdmflrwsddlvtflsshvsqedfqitmdafa
    ayndftratiaarradptddlvsvlvssevdgerlsddelvmetlliliggdettrhtls
    ggteqllrnrdqwdllqrdpsllpgaieemlrwtapvknmcrvltadtefhgtalcagek
    mmllfesanfdeavfcepekfdvqrnpnshlafgfgthfclgnqlarlelslmtervlrr
    lpdlrlvaddsvlplrpanfvsglesmpvvftpspplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xkrA (A:)
    apdvdladgnfyasrearaayrwmranqpvfrdrnglaaastyqavidaerqpelfsnag
    girpdqpalpmmidmddpahllrrklvnagftrkrvkdkeasiaalcdtlidavcergec
    dfvrdlaaplpmavigdmlgvrpeqrdmflrwsddlvtflsshvsqedfqitmdafaayn
    dftratiaarradptddlvsvlvssevdgerlsddelvmetlliliggdettrhtlsggt
    eqllrnrdqwdllqrdpsllpgaieemlrwtapvknmcrvltadtefhgtalcagekmml
    lfesanfdeavfcepekfdvqrnpnshlafgfgthfclgnqlarlelslmtervlrrlpd
    lrlvaddsvlplrpanfvsglesmpvvftpspplg