PDB entry 2xkn

View 2xkn on RCSB PDB site
Description: crystal structure of the fab fragment of the anti-egfr antibody 7a7
Class: immune system
Keywords: immune system, immunoglobulin
Deposited on 2010-07-09, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1454
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-egfr antibody 7a7
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2XKN (0-End)
    Domains in SCOPe 2.07: d2xkna1, d2xkna2
  • Chain 'B':
    Compound: anti-egfr antibody 7a7
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2XKN (0-End)
  • Chain 'C':
    Compound: anti-egfr antibody 7a7
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2XKN (0-End)
    Domains in SCOPe 2.07: d2xknc1, d2xknc2
  • Chain 'D':
    Compound: anti-egfr antibody 7a7
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2XKN (0-End)
  • Heterogens: PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xknA (A:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvts
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnecevmlvesgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xknA (A:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvts
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xknC (C:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvts
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnecevmlvesgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xknC (C:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvts
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.