PDB entry 2xkm

View 2xkm on RCSB PDB site
Description: consensus structure of pf1 filamentous bacteriophage from x-ray fibre diffraction and solid-state nmr
Deposited on 2010-07-09, released 2010-11-24
The last revision was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: FIBER;SOLID-STATENMR
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein G8P
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xkmA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka