PDB entry 2xki

View 2xki on RCSB PDB site
Description: Aquo-met structure of C.lacteus mini-Hb
Class: oxygen storage
Keywords: oxygen storage, metal-binding
Deposited on 2010-07-08, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neural hemoglobin
    Species: CEREBRATULUS LACTEUS [TaxId:6221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xkia_
  • Heterogens: HEM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xkiA (A:)
    mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
    adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl