PDB entry 2xkh

View 2xkh on RCSB PDB site
Description: xe derivative of c.lacteus mini-hb leu86ala mutant
Class: oxygen storage
Keywords: oxygen storage, oxygen transport, xe derivative, metal-binding
Deposited on 2010-07-08, released 2010-12-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.20102
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neural hemoglobin
  Species: CEREBRATULUS LACTEUS [TaxId:6221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76242 (0-109)
    • engineered mutation (86)
  Domains in SCOPe 2.01: d2xkha_
• Heterogens: HEM, OXY, SO4, XE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xkhA (A:)
  mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
  adaaglasrhkgrnvgsaefhnakacaakacsahgapdlghaiddilshl