PDB entry 2xkh

View 2xkh on RCSB PDB site
Description: Xe derivative of C.lacteus mini-Hb Leu86Ala mutant
Class: oxygen storage
Keywords: oxygen storage, oxygen transport, xe derivative, metal-binding
Deposited on 2010-07-08, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neural hemoglobin
  Species: CEREBRATULUS LACTEUS [TaxId:6221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76242 (0-109)
    • engineered mutation (86)
  Domains in SCOPe 2.08: d2xkha_
• Heterogens: HEM, OXY, SO4, XE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xkhA (A:)
  mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
  adaaglasrhkgrnvgsaefhnakacaakacsahgapdlghaiddilshl