PDB entry 2xkg

View 2xkg on RCSB PDB site
Description: c.lacteus mini-hb leu86ala mutant
Class: oxygen storage
Keywords: oxygen storage, metal-binding
Deposited on 2010-07-08, released 2010-12-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.15529
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neural hemoglobin
    Species: CEREBRATULUS LACTEUS [TaxId:6221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76242 (0-109)
      • engineered mutation (86)
    Domains in SCOPe 2.01: d2xkga_
  • Heterogens: HEM, OXY, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xkgA (A:)
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakacaakacsahgapdlghaiddilshl