PDB entry 2xk3

View 2xk3 on RCSB PDB site
Description: structure of nek2 bound to aminopyrazine compound 35
Class: transferase
Keywords: transferase, centrosome, mitosis
Deposited on 2010-07-07, released 2010-10-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1876
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • expression tag (271-278)
    Domains in SCOPe 2.05: d2xk3a_
  • Heterogens: XK3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xk3A (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xk3A (A:)
    sraedyevlytigtrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelkhpn
    ivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalke
    chrrsrdlkpanvfldgkqnvklgdfgvgtpyymspeqmnrneksdiwslgcllyelcal
    mppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeilenplil
    ehhhhhh