PDB entry 2xk0

View 2xk0 on RCSB PDB site
Description: solution structure of the tudor domain from drosophila polycomblike (pcl)
Deposited on 2010-07-07, released 2010-08-11
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polycomb protein pcl
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24459 (3-68)
      • expression tag (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xk0A (A:)
gamappvaapspavtyalqedvfikcndgrfylgtiidqtsdqylirfddqseqwcepdk
lrklgggss