PDB entry 2xjy

View 2xjy on RCSB PDB site
Description: crystal structure of the lmo2:ldb1-lid complex, p21 crystal form
Deposited on 2010-07-06, released 2010-07-21
The last revision was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2024
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhombotin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: lim domain-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xjyA (A:)
    slltcggcqqnigdryflkaidqywhedclscdlcgcrlgevgrrlyyklgrklcrrdyl
    rlfgqdglcascdkrirayemtmrvkdkvyhlecfkcaacqkhfcvgdryllinsdivce
    qdiyewtking
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xjyB (B:)
    vpdvmvvgeptlmggefgdederlitrlentqfda