PDB entry 2xjv

View 2xjv on RCSB PDB site
Description: X-ray structure of the N-terminal domain of the flocculin Flo5 from Saccharomyces cerevisiae with mutation D201T in complex with calcium and glucose
Class: cell adhesion
Keywords: cell adhesion, greenbeard, social interaction, pa14-domain, carbohydrate binding
Deposited on 2010-07-06, released 2010-12-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flocculation protein flo5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38894 (9-257)
      • expression tag (0-8)
      • engineered mutation (188)
    Domains in SCOPe 2.08: d2xjva1, d2xjva2
  • Heterogens: CA, NA, CL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xjvA (A:)
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslptnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih