PDB entry 2xju

View 2xju on RCSB PDB site
Description: X-ray structure of the N-terminal domain of the flocculin Flo5 from Saccharomyces cerevisiae with mutation S227A in complex with calcium and a1,2-mannobiose
Class: cell adhesion
Keywords: cell adhesion, greenbeard, social interaction, pa14-domain, carbohydrate binding
Deposited on 2010-07-06, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flocculation protein flo5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38894 (9-257)
      • expression tag (0-8)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d2xjua1, d2xjua2
  • Heterogens: CA, NA, CL, GOL, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xjuA (A:)
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslpdnitgtvymyagyyyplkvvysnavawgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih