PDB entry 2xjt

View 2xjt on RCSB PDB site
Description: X-ray structure of the N-terminal domain of the flocculin Flo5 from Saccharomyces cerevisiae in complex with calcium and Man5(D1)
Class: cell adhesion
Keywords: cell adhesion, greenbeard, social interaction, pa14-domain, carbohydrate binding
Deposited on 2010-07-06, released 2010-12-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: flocculation protein flo5
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38894 (9-257)
    • expression tag (0-8)
  Domains in SCOPe 2.08: d2xjta1, d2xjta2
• Heterogens: CA, NA, CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xjtA (A:)
  glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
  ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
  tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
  kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
  fdddlsqsnctipdpsih