PDB entry 2xjs

View 2xjs on RCSB PDB site
Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and a1,2-mannobiose
Class: cell adhesion
Keywords: cell adhesion, greenbeard, social interaction, pa14-domain, carbohydrate binding
Deposited on 2010-07-06, released 2010-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.12344
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flocculation protein flo5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38894 (9-257)
      • expression tag (0-8)
    Domains in SCOPe 2.04: d2xjsa_
  • Heterogens: CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xjsA (A:)
    glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
    ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
    tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
    kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
    fdddlsqsnctipdpsih