PDB entry 2xjr

View 2xjr on RCSB PDB site
Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and man5(d2-d3)
Class: cell adhesion
Keywords: cell adhesion, greenbeard, pa14-domain, carbohydrate binding, social interaction
Deposited on 2010-07-06, released 2010-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.11369
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flocculation protein flo5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38894 (9-257)
      • expression tag (1-8)
    Domains in SCOPe 2.06: d2xjra1, d2xjra2
  • Heterogens: CA, NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xjrA (A:)
    glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
    ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
    tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
    kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
    fdddlsqsnctipdpsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjrA (A:)
    lvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvg
    gqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttpt
    nvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingik
    pwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysf
    dddlsqsnctipdpsih