PDB entry 2xjq

View 2xjq on RCSB PDB site
Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae
Class: cell adhesion
Keywords: cell adhesion, greenbeard, pa14-domain, carbohydrate binding, social interaction
Deposited on 2010-07-06, released 2010-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.14309
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flocculation protein flo5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38894 (9-257)
      • expression tag (0-8)
    Domains in SCOPe 2.04: d2xjqa_
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xjqA (A:)
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih