PDB entry 2xjn

View 2xjn on RCSB PDB site
Description: crystal structure of streptococcus suis dpr with copper
Class: oxidoreductase
Keywords: oxidoreductase, iron storage, metal-binding
Deposited on 2010-07-06, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16225
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjna_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnb_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnc_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnd_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjne_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnf_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjng_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnh_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjni_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnj_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnk_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjnl_
  • Heterogens: CU, CL, EPE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xjnA (A:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnA (A:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xjnB (B:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnB (B:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xjnC (C:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnC (C:)
    dskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlitl
    ggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegdsv
    tndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xjnD (D:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnD (D:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xjnE (E:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnE (E:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xjnF (F:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnF (F:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2xjnG (G:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnG (G:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xjnH (H:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnH (H:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2xjnI (I:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnI (I:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2xjnJ (J:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnJ (J:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2xjnK (K:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnK (K:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2xjnL (L:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjnL (L:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl