PDB entry 2xjm

View 2xjm on RCSB PDB site
Description: crystal structure of streptococcus suis dpr with cobalt
Class: oxidoreductase
Keywords: oxidoreductase, iron storage, metal-binding
Deposited on 2010-07-06, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17986
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjma_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmb_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmc_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmd_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjme_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmf_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmg_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmh_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmi_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmj_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjmk_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xjml_
  • Heterogens: CO, CL, CA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xjmA (A:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmA (A:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xjmB (B:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmB (B:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xjmC (C:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmC (C:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xjmD (D:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmD (D:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xjmE (E:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmE (E:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xjmF (F:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmF (F:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2xjmG (G:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmG (G:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xjmH (H:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmH (H:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2xjmI (I:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmI (I:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2xjmJ (J:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmJ (J:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2xjmK (K:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmK (K:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2xjmL (L:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xjmL (L:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl